PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G016800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 388aa    MW: 43720.7 Da    PI: 8.6121
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G016800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.2e-53161431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yLk+k+++k+l++ e i+++diyk++PwdLpk ++a+ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++
  Brast04G016800.1.p  16 MLPGFRFHPTDEELVRFYLKRKIQQKSLPI-ELIRQLDIYKFDPWDLPKLASAGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDRP 105
                         579***************************.89***************8888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  Brast04G016800.1.p 106 IYSSdGSKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 143
                         ***966677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5814175IPR003441NAC domain
PROSITE profilePS5100556.88416175IPR003441NAC domain
PfamPF023651.4E-2518143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEEIRSDDIE KQDEVMLPGF RFHPTDEELV RFYLKRKIQQ KSLPIELIRQ LDIYKFDPWD  60
LPKLASAGEK EWYFYCPRDR KYRNSTRPNR VTGAGFWKAT GTDRPIYSSD GSKCIGLKKS  120
LVFYKGRAAK GIKTDWMMHE FRLPSLTDPS LLQKKPLEKT IPPNDSWAIC RIFKKTNATA  180
QRAISHSWVS PPLPSTNGTY NPPHLHTTHR SRHSTENTLS TMTNIISSNI QFTGSGYFPS  240
TVSSCQNTLN ILDSISRPAT SIVLPPPDSE HQTMSILSAI PLDLPAGMDI ASMVLNTSPI  300
TLPSMNRSTP TSIEFVQPQQ CSNSMSNRCV VDLPDIGNNV NCVTRSINFP FSMQGSISDE  360
WRATVPWDSL PCTTEVSTNY HSTKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-531817717170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0041141e-105AP004114.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1118_G04.
GenBankAP0149581e-105AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-105CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236120.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW51e-106NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLI1IFB10.0I1IFB1_BRADI; Uncharacterized protein
STRINGBRADI3G59380.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137172629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-108NAC domain containing protein 94